Some medical experts said the blue liquid was likely methylene blue, a man-made dye that has become popular in alternative medicine circles for its potential health benefits. Early studies have ...

In cancer research, methylene blue has shown potential as a “photosensitiser” in treatments using laser light – meaning it makes certain cancer cells more vulnerable to treatment.

The chemical compound known as methylene blue boasts a long history of use in numerous medical settings. Its importance is primarily drawn from its ability to enhance mitochondrial function.

Wacker-Lehrstuhl für Makromolekulare Chemie, Catalysis Research Center, Technische Universität München, TUM School of Natural Sciences, Lichtenbergstraße 4, 85748 Garching, Germany ...

Introduction: Anti-N-methyl-D-aspartate receptor (NMDAR ... 356 − 385 peptide (LQNRKLVQVGIYNGTHVIPNDRKIIWPGGE, Genscript) to conduct active immunization in the NMDARE group. Mice were subjected to ...

Click or tap to start it In the search box on the top right, type “group.” Look for Administrative Tools > Edit group policy Click to launch it It is useful for those who use the Control Panel ...

Objective: To investigate whether methylene blue (MB) treatment can reverse neuronal ... treatment groups. In the MB treatment group, the culture medium was treated with 4.5 μM 1% MB (20) at the same ...